PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv1_018000_grua.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family HD-ZIP
Protein Properties Length: 301aa    MW: 33852.5 Da    PI: 9.3331
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv1_018000_grua.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.93.4e-18131185256
                         T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         rk+ +++keq+ +Le++F+++ +++++++  LA++++L  rqV vWFqNrRa+ k
  Bv1_018000_grua.t1 131 RKKLRLSKEQIMVLEQAFREHTTLNTKQKVALANQVNLRPRQVEVWFQNRRARTK 185
                         788899***********************************************98 PP

2HD-ZIP_I/II118.34.3e-38131219190
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                         +kk+rlskeq+ +LE+ F+e+++L++++Kv+la++++l+prqv+vWFqnrRARtk+kq+E+d+e+L++ +++l+een++L+kev+eLr +
  Bv1_018000_grua.t1 131 RKKLRLSKEQIMVLEQAFREHTTLNTKQKVALANQVNLRPRQVEVWFQNRRARTKLKQTEVDCEYLRTLCESLTEENKQLQKEVHELR-T 219
                         69*************************************************************************************9.4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.6E-19119185IPR009057Homeodomain-like
SuperFamilySSF466891.24E-18119188IPR009057Homeodomain-like
PROSITE profilePS5007117.556127187IPR001356Homeobox domain
SMARTSM003892.3E-15129191IPR001356Homeobox domain
PfamPF000461.7E-15131185IPR001356Homeobox domain
CDDcd000867.98E-14132188No hitNo description
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PfamPF021834.0E-8187219IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.2E-17187230IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 301 aa     Download sequence    Send to blast
MGEEDNFQFW GLSLSLKPPI THLHHKPILC KREPQFSTDD EQSQKIQKSN KTLVMMPRID  60
MGVELKQQVP LVIDLEEVDI AGKVGSPNST LSSATCKRLG GFSGERDMIS DDEGDNRGGC  120
GGGGGGERGE RKKLRLSKEQ IMVLEQAFRE HTTLNTKQKV ALANQVNLRP RQVEVWFQNR  180
RARTKLKQTE VDCEYLRTLC ESLTEENKQL QKEVHELRTL NVSSEQSFIH SKLHPPTTLT  240
MCPSCKTASL SSSSATTKSP TNDTGRYPAG VFTRRPIPHN LKKLSLTLNS NRMFEAHLPR  300
S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179187RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010692080.10.0PREDICTED: homeobox-leucine zipper protein HAT3
SwissprotP466029e-59HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A0J8EA680.0A0A0J8EA68_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60390.16e-48homeobox-leucine zipper protein 3